UXS1 Peptide - N-terminal region
UXS1 Peptide - N-terminal region
Product Specifications
UniProt
B3KV61
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UXS1 Rabbit Polyclonal Antibody (orb580917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]](https://cdn.genprice.uk/products/763/68dd149c061270361e7cf526/imageurl/e-ab-f1199um.webp)
E-AB-F1199UM-01 25 µg
Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]
Sign In for Pricing
View Details E-AB-F1199UM-02 100 µg
Elab Fluor® 647 Anti-Mouse IL-17A Antibody[TC11-18H10.1]
Sign In for Pricing
View Details 
![Bis(2-chloroethyl) Ether(1,1'-Oxybis[2-chloro-ethane])](https://cdn.genprice.uk/products/572/7692297769192/imageurl/trc-o870525-5g.webp)
TRC-O870525-5G 5 g
Bis(2-chloroethyl) Ether(1,1'-Oxybis[2-chloro-ethane])
Sign In for Pricing
View Details ![GLI4 Mouse Monoclonal Antibody [Clone ID: OTI2E8]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907e90/imageurl/cf806231.webp)
