Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARID5B Peptide - N-terminal region

ARID5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DESRT, MRF-2, MRF2

UniProt

Q14865

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARID5B Rabbit Polyclonal Antibody (orb581184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115575

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody
AP02498PU-S 50 µL

ERK1 (MAPK3) pThr202 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D-Glucosaminic Acid
TRC-G523000-500MG 500 mg

D-Glucosaminic Acid

Sign In for Pricing
View Details
GPR85 (NM_001146267) Human Over-expression Lysate
LC431879 20 µg

GPR85 (NM_001146267) Human Over-expression Lysate

Sign In for Pricing
View Details
GOLGA3 Antibody
KC-713-01 50 μL

GOLGA3 Antibody

Sign In for Pricing
View Details
GOLGA3 Antibody
KC-713-02 100 µL

GOLGA3 Antibody

Sign In for Pricing
View Details
GOLGA3 Antibody
KC-713-03 1 mL

GOLGA3 Antibody

Sign In for Pricing
View Details