Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARID5B Peptide - N-terminal region

ARID5B Peptide - N-terminal region

Product Specifications

Product Name Alternative

DESRT, MRF-2, MRF2

UniProt

Q14865

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARID5B Rabbit Polyclonal Antibody (orb581184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115575

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLPEDTPQGRNSDHGEDEVIAVSEKVIVKLEDLVKWVHSDFSKWRCGFHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLFN14 (NM_001129820) Human Over-expression Lysate
LC427046 20 µg

SLFN14 (NM_001129820) Human Over-expression Lysate

Sign In for Pricing
View Details
Telomerase reverse transcriptase (TERT) pTyr707 Rabbit Polyclonal Antibody
AP13029PU-N 400 µL

Telomerase reverse transcriptase (TERT) pTyr707 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calpain 5 (CAPN5) (NM_004055) Human Over-expression Lysate
LY418247 100 µg

Calpain 5 (CAPN5) (NM_004055) Human Over-expression Lysate

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein, His Tag (BA.3/Omicron) (MALS verified)
SPN-C522c-10mg 10 mg

SARS-CoV-2 Spike Trimer Protein, His Tag (BA.3/Omicron) (MALS verified)

Sign In for Pricing
View Details
ATF1 Rabbit Monoclonal Antibody
TA422759 100 µL

ATF1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human IL-17C, C-hFc Tag
HA211315-01 20 µg

Human IL-17C, C-hFc Tag

Sign In for Pricing
View Details