MAGED4 Peptide - middle region
MAGED4 Peptide - middle region
Product Specifications
Product Name Alternative
MAGE1, MAGEE1, MAGE-E1
UniProt
Q96JG8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MAGED4 Rabbit Polyclonal Antibody (orb55686) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001092270.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGILGTTKDSPKLGLLMVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1257506-01 0.02 mg (E-Coli)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details MBS1257506-02 0.02 mg (Yeast)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details MBS1257506-03 0.1 mg (E-Coli)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details MBS1257506-04 0.1 mg (Yeast)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details MBS1257506-05 0.02 mg (Baculovirus)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details MBS1257506-06 0.02 mg (Mammalian-Cell)
Recombinant Tomato yellow leaf curl virus Capsid protein (V1)
Sign In for Pricing
View Details