Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUX4 Peptide - middle region

DUX4 Peptide - middle region

Product Specifications

UniProt

Q9UBX2

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUX4 Rabbit Polyclonal Antibody (orb581276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001264985

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBX21 Antibody, HRP conjugated
MBS7051511-01 0.05 mg

TBX21 Antibody, HRP conjugated

Sign In for Pricing
View Details
TBX21 Antibody, HRP conjugated
MBS7051511-02 0.1 mg

TBX21 Antibody, HRP conjugated

Sign In for Pricing
View Details
TBX21 Antibody, HRP conjugated
MBS7051511-03 5x 0.1 mg

TBX21 Antibody, HRP conjugated

Sign In for Pricing
View Details
Phospho-hnRNP K (Ser284) Peptide
AF5442-BP 1 mg

Phospho-hnRNP K (Ser284) Peptide

Sign In for Pricing
View Details
ZFAND2A (NM_182491) Human Tagged ORF Clone
RC206898 10 µg

ZFAND2A (NM_182491) Human Tagged ORF Clone

Sign In for Pricing
View Details
DOK1 Antibody
MBS9215855-01 0.1 mL

DOK1 Antibody

Sign In for Pricing
View Details