DUX4 Peptide - middle region
DUX4 Peptide - middle region
Product Specifications
UniProt
Q9UBX2
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUX4 Rabbit Polyclonal Antibody (orb581276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001264985
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ESRPWPGRRGPPEGRRKRTAVTGSQTALLLRAFEKDRFPGIAAREELARE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9392846-01 48 Well
Monkey Calcium Binding and Coiled Coil Domain Containing Protein 2 (CALCOCO2) ELISA Kit
Sign In for Pricing
View Details MBS9392846-02 96 Well
Monkey Calcium Binding and Coiled Coil Domain Containing Protein 2 (CALCOCO2) ELISA Kit
Sign In for Pricing
View Details