HSFY2 Peptide - middle region
HSFY2 Peptide - middle region
Product Specifications
Product Name Alternative
HSF2L, HSFY
UniProt
Q96LI6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSFY2 Rabbit Polyclonal Antibody (orb325681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_714927
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx219120-01 50 µg
Trafficking Protein Particle Complex Subunit 1 (TRAPPC1) Antibody
Sign In for Pricing
View Details 
abx219120-02 100 µg
Trafficking Protein Particle Complex Subunit 1 (TRAPPC1) Antibody
Sign In for Pricing
View Details GTR15306481 1 Vial
Lentiviral mouse Otud3 shRNA (UAS) - Lentiviral mouse Otud3 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details LV654445 1.0 µg DNA
Prorsd1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details