Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSFY2 Peptide - middle region

HSFY2 Peptide - middle region

Product Specifications

Product Name Alternative

HSF2L, HSFY

UniProt

Q96LI6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSFY2 Rabbit Polyclonal Antibody (orb325681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_714927

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSQGSLLESPSYTVCVSEPDKDDDFLSLNFPRKLWKIVESDQFKSISWDE

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCY5 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-3922R-BF750-TR 20 µL

ADCY5 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal PHOSPHO1 Antibody (011) [FITC]
NBP2-90192F 0.1 mL

Rabbit Monoclonal PHOSPHO1 Antibody (011) [FITC]

Sign In for Pricing
View Details
Anti-Phospho-NDRG1 (Ser330) Antibody (R2M91)
RHK70201 100 μg

Anti-Phospho-NDRG1 (Ser330) Antibody (R2M91)

Sign In for Pricing
View Details
TIP60 Rabbit pAb
MBS8541172-01 0.1 mL

TIP60 Rabbit pAb

Sign In for Pricing
View Details
TIP60 Rabbit pAb
MBS8541172-02 0.1 mL (AF405L)

TIP60 Rabbit pAb

Sign In for Pricing
View Details
TIP60 Rabbit pAb
MBS8541172-03 0.1 mL (AF405S)

TIP60 Rabbit pAb

Sign In for Pricing
View Details