Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRRC17 Peptide - middle region

LRRC17 Peptide - middle region

Product Specifications

Product Name Alternative

P37NB

UniProt

Q8N6Y2

Field of Research

Neuroscience; Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRRC17 Rabbit Polyclonal Antibody (orb581471) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005815

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Meprin A Alpha (MEP1a)
RPU42738-01 50 µg

Recombinant Human Meprin A Alpha (MEP1a)

Sign In for Pricing
View Details
Recombinant Human Meprin A Alpha (MEP1a)
RPU42738-02 100 µg

Recombinant Human Meprin A Alpha (MEP1a)

Sign In for Pricing
View Details
Recombinant Human Meprin A Alpha (MEP1a)
RPU42738-03 1 mg

Recombinant Human Meprin A Alpha (MEP1a)

Sign In for Pricing
View Details
LIMK 1 Antibody, mAb, Rabbit
A04940-100 100 µL

LIMK 1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Mouse Monoclonal human CD9 Antibody
orb1153585 100 µg

Mouse Monoclonal human CD9 Antibody

Sign In for Pricing
View Details
CH 5450 10mM * 1mL in DMSO
A21974-10mM-D 10 mM x 1mL in DMSO

CH 5450 10mM * 1mL in DMSO

Sign In for Pricing
View Details