LRRC17 Peptide - middle region
LRRC17 Peptide - middle region
Product Specifications
Product Name Alternative
P37NB
UniProt
Q8N6Y2
Field of Research
Neuroscience; Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LRRC17 Rabbit Polyclonal Antibody (orb581471) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_005815
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7505-53-01 1 g
Coenzyme Q10 (Vitamin-Q10, Ubichinon-50, Ubidecarenone, Coenzyme-Q10, Ubiquinone-Q10)
Sign In for Pricing
View Details C7505-53-02 5 g
Coenzyme Q10 (Vitamin-Q10, Ubichinon-50, Ubidecarenone, Coenzyme-Q10, Ubiquinone-Q10)
Sign In for Pricing
View Details C7505-53-03 10 g
Coenzyme Q10 (Vitamin-Q10, Ubichinon-50, Ubidecarenone, Coenzyme-Q10, Ubiquinone-Q10)
Sign In for Pricing
View Details C7505-53-04 25 g
Coenzyme Q10 (Vitamin-Q10, Ubichinon-50, Ubidecarenone, Coenzyme-Q10, Ubiquinone-Q10)
Sign In for Pricing
View Details