Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK1 Peptide - C-terminal region

DKK1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKK-1, SK

UniProt

O94907

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DKK1 Rabbit Polyclonal Antibody (orb582605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_036374

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)
abx306249-01 20 µg

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)
abx306249-02 50 µg

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)
abx306249-03 100 µg

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)
abx306249-04 200 µg

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)

Sign In for Pricing
View Details
Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)
abx306249-05 1 mg

Zinc Finger Protein 689 (ZNF689) Antibody (Biotin)

Sign In for Pricing
View Details
Axl Antibody BIOTIN-Conjugated
MBS541030-01 0.1 mg

Axl Antibody BIOTIN-Conjugated

Sign In for Pricing
View Details