Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SESN1 Peptide - middle region

SESN1 Peptide - middle region

Product Specifications

Product Name Alternative

PA26, SEST1

UniProt

Q9Y6P5

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SESN1 Rabbit Polyclonal Antibody (orb582610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055269

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (ICO-97), CF640R conjugate, 0.1mg/mL
BNC400758-100 1x 100 µL

Human IgG Immunoglobulin (ICO-97), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF281 Human Gene Knockout Kit (CRISPR)
KN209243RB 1 Kit

ZNF281 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Glechoma hederacea Lectin (ground ivy) -GHA-,  10nm
GP-9003-10 1 mL

Colloidal Gold Conjugated Glechoma hederacea Lectin (ground ivy) -GHA-, 10nm

Sign In for Pricing
View Details
NPSR1 Rabbit Polyclonal Antibody
TA379270 100 µL

NPSR1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PD-L2 Recombinant Rabbit monoclonal Antibody
HA723148B 100 µL

Human PD-L2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD46 (197-2B1), CF488A conjugate, 0.1mg/mL
BNC880931-500 1x 500 µL

CD46 (197-2B1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details