SESN1 Peptide - middle region
SESN1 Peptide - middle region
Product Specifications
Product Name Alternative
PA26, SEST1
UniProt
Q9Y6P5
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SESN1 Rabbit Polyclonal Antibody (orb582610) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055269
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KWLNGLENAPQKLQNLGELNKVLAHRPWLITKEHIEGLLKAEEHSWSLAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![EPO Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D8]](https://cdn.genprice.uk/products/937/68dd1b86061270361ea20947/imageurl/ta812059am.webp)
TA812059AM 100 µL
EPO Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D8]
Sign In for Pricing
View Details 
BNCB3409-100 1x 100 µL
CD20 / MS4A1 (B-Cell Marker) (MS4A1/3409), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
AP52142PU-N 400 µL
PIP3E (IPCEF1) (C-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
GM-19-40 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Human IgE, 40nm
Sign In for Pricing
View Details 