Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD8 Peptide - N-terminal region

CARD8 Peptide - N-terminal region

Product Specifications

UniProt

Q9Y2G2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD8 Rabbit Polyclonal Antibody (orb582641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTRL Polyclonal Conjugated Antibody
orb1627695 100 µL

CNTRL Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
HSC 70 Polyclonal Antibody
UB-GEN-15709 100 µL

HSC 70 Polyclonal Antibody

Sign In for Pricing
View Details
Innovative Grade US Origin Bovine Artery Pulmonary Heart to Lungs Fresh in Saline
IGBOARPMST1 1 Each

Innovative Grade US Origin Bovine Artery Pulmonary Heart to Lungs Fresh in Saline

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody
AMM81033-01 1 Each

MCM2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody
AMM81033-02 50 µL

MCM2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
MCM2 Mouse Monoclonal Antibody
AMM81033-03 100 µL

MCM2 Mouse Monoclonal Antibody

Sign In for Pricing
View Details