Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD8 Peptide - N-terminal region

CARD8 Peptide - N-terminal region

Product Specifications

UniProt

Q9Y2G2

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD8 Rabbit Polyclonal Antibody (orb582641) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGGTFPGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal TIP120A Antibody [DyLight 350]
NBP1-49918UV 0.1 mL

Rabbit Polyclonal TIP120A Antibody [DyLight 350]

Sign In for Pricing
View Details
IL-15, Human
Z03308-1 1 mg

IL-15, Human

Sign In for Pricing
View Details
Anti-HAP1 Antibody Picoband®, iFluor647 Conjugate
A01658-3-iFluor647 100 µg

Anti-HAP1 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
LST1 CRISPR/Cas9 KO Plasmid (m2)
sc-421476-KO-2 20 µg

LST1 CRISPR/Cas9 KO Plasmid (m2)

Sign In for Pricing
View Details
MIRacle™ hsa-miR-3151-5p miRNA Agomir/Antagomir
AM2207 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-3151-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
Lentiviral human AWAT1 sgRNA gene knockout kit - Lentiviral human AWAT1 sgRNA gene knockout kit (plasmid)
GTR15365864 1 Vial

Lentiviral human AWAT1 sgRNA gene knockout kit - Lentiviral human AWAT1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details