FTSJD2 Peptide - C-terminal region
FTSJD2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIAA0082, MTr1, hMTr1, FTSJD2
UniProt
Q8N1G2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FTSJD2 Rabbit Polyclonal Antibody (orb325964) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055865
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YRLEEMEKIFVRLEMKIIKGSSGTPKLSYTGRDDRHFVPMGLYIVRTVNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PDER100194-01 20 µg
Recombinant Rat Ferritin heavy chain protein (His tag)
Sign In for Pricing
View Details PDER100194-02 100 µg
Recombinant Rat Ferritin heavy chain protein (His tag)
Sign In for Pricing
View Details PDER100194-03 500 µg
Recombinant Rat Ferritin heavy chain protein (His tag)
Sign In for Pricing
View Details PDER100194-04 1 mg
Recombinant Rat Ferritin heavy chain protein (His tag)
Sign In for Pricing
View Details 
