MTBP Peptide - middle region
MTBP Peptide - middle region
Product Specifications
UniProt
B4DUR5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTBP Rabbit Polyclonal Antibody (orb582738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
132245-PE 100 µL
RABL6 (C9orf86, Rab-like Protein 6, GTP-binding Protein Parf, Partner of ARF, Rab-like Protein 1, RBEL1, C9orf86, PARF, FLJ10101, FLJ13045) (PE)
Sign In for Pricing
View Details 
