MTBP Peptide - middle region
MTBP Peptide - middle region
Product Specifications
UniProt
B4DUR5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MTBP Rabbit Polyclonal Antibody (orb582738) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLADLYEEAAENLHQLSDKLPAPGRAMVDIILLLSDKDPPKLKDYLPTVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC225672L3V 200 µL
CDCA7L (NM_001127370) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details K4493308 1.0 µg DNA
Fam178b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
Sign In for Pricing
View Details 
MBS1345609-01 0.02 mg (E-Coli)
Recombinant Syntrophomonas wolfei subsp. wolfei Cell division protein SepF (sepF)
Sign In for Pricing
View Details MBS1345609-02 0.1 mg (E-Coli)
Recombinant Syntrophomonas wolfei subsp. wolfei Cell division protein SepF (sepF)
Sign In for Pricing
View Details MBS1345609-03 0.02 mg (Yeast)
Recombinant Syntrophomonas wolfei subsp. wolfei Cell division protein SepF (sepF)
Sign In for Pricing
View Details