Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRWD1 Peptide - middle region

LRWD1 Peptide - middle region

Product Specifications

Product Name Alternative

LOC304396

UniProt

Q66HB0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRWD1 Rabbit Polyclonal Antibody (orb326010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014003

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH I (MARCH1) (NM_001166373) Human Over-expression Lysate
LY432839 100 µg

MARCH I (MARCH1) (NM_001166373) Human Over-expression Lysate

Sign In for Pricing
View Details
Serping1 Mouse Gene Knockout Kit (CRISPR)
KN515608 1 Kit

Serping1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human C12orf43 activation kit by CRISPRa
GA112189 1 Kit

Human C12orf43 activation kit by CRISPRa

Sign In for Pricing
View Details
CD247 (NM_198053) Human Over-expression Lysate
LY403667 100 µg

CD247 (NM_198053) Human Over-expression Lysate

Sign In for Pricing
View Details
Mabuterol
TRC-M104000-10MG 10 mg

Mabuterol

Sign In for Pricing
View Details
4-(3’,4’-Dichlorophenyl)-3,4-dihydro-2H-naphthalen-1-one Oxime
TRC-D435710-50MG 50 mg

4-(3’,4’-Dichlorophenyl)-3,4-dihydro-2H-naphthalen-1-one Oxime

Sign In for Pricing
View Details