Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRWD1 Peptide - middle region

LRWD1 Peptide - middle region

Product Specifications

Product Name Alternative

LOC304396

UniProt

Q66HB0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRWD1 Rabbit Polyclonal Antibody (orb326010) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014003

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPLHFLQCHSRNNSPKDLETQLWACAFEPAREEGHSGATSQTVATCGGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF740 conjugate, 0.1mg/mL
BNC741840-100 1x 100 µL

Cytokeratin 1 (Suprabasal Keratinocyte Marker) (KRT1/1840), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTC23 Rabbit Polyclonal Antibody
TA369427 100 µL

TTC23 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EEF1D Rabbit Polyclonal Antibody
TA366323 100 µL

EEF1D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OptiWell™ Deep Well Plates
D3096-09 50 Units/Case

OptiWell™ Deep Well Plates

Sign In for Pricing
View Details
1,1-Diethoxy-2-nitroethane
TRC-D476983-50MG 50 mg

1,1-Diethoxy-2-nitroethane

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (G446V) (His Tag)
PKSV030446 100 µg

Recombinant SARS-CoV-2 Spike RBD (G446V) (His Tag)

Sign In for Pricing
View Details