Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED19 Peptide - middle region

MED19 Peptide - middle region

Product Specifications

Product Name Alternative

DT2P1G7, LCMR1

UniProt

A0JLT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED19 Rabbit Polyclonal Antibody (orb582814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_703151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-H Cadherin Rabbit pAb
GB11996-100 100 μL

Anti-H Cadherin Rabbit pAb

Sign In for Pricing
View Details
Defb14 Antibody, FITC conjugated
CSB-PA749254HC01MO-01 50 µg

Defb14 Antibody, FITC conjugated

Sign In for Pricing
View Details
Defb14 Antibody, FITC conjugated
CSB-PA749254HC01MO-02 100 µg

Defb14 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral mouse Zfp992 shRNA (UAS) - Lentiviral mouseZfp992 shRNA (UAS, GFP) (25)
GTR15168728 1 Vial

Lentiviral mouse Zfp992 shRNA (UAS) - Lentiviral mouseZfp992 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
SSH1, NT (SSH1, KIAA1298, SSH1L, Protein phosphatase Slingshot homolog 1, SSH-like protein 1)
042326 200 µL

SSH1, NT (SSH1, KIAA1298, SSH1L, Protein phosphatase Slingshot homolog 1, SSH-like protein 1)

Sign In for Pricing
View Details
Ephrin Type A Receptor 1 (EPHA1) Human ELISA Kit
D1970 96 Tests

Ephrin Type A Receptor 1 (EPHA1) Human ELISA Kit

Sign In for Pricing
View Details