Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MED19 Peptide - middle region

MED19 Peptide - middle region

Product Specifications

Product Name Alternative

DT2P1G7, LCMR1

UniProt

A0JLT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MED19 Rabbit Polyclonal Antibody (orb582814) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

ChIP, WB

NCBI Accession Number

NP_703151

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POMK Peptide
DF15837-BP 1 mg

POMK Peptide

Sign In for Pricing
View Details
Recombinant Human Augurin (ECRG4), partial
CSB-EP887957HU-01 10 µg

Recombinant Human Augurin (ECRG4), partial

Sign In for Pricing
View Details
Recombinant Human Augurin (ECRG4), partial
CSB-EP887957HU-02 50 µg

Recombinant Human Augurin (ECRG4), partial

Sign In for Pricing
View Details
Recombinant Human Augurin (ECRG4), partial
CSB-EP887957HU-03 200 µg

Recombinant Human Augurin (ECRG4), partial

Sign In for Pricing
View Details
Recombinant Human Augurin (ECRG4), partial
CSB-EP887957HU-04 500 µg

Recombinant Human Augurin (ECRG4), partial

Sign In for Pricing
View Details
Recombinant Human Augurin (ECRG4), partial
CSB-EP887957HU-05 20 µg

Recombinant Human Augurin (ECRG4), partial

Sign In for Pricing
View Details