Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRA1A Peptide - C-terminal region

ADRA1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADRA1C, ADRA1L1, ALPHA1AAR

UniProt

P35348

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRA1A Rabbit Polyclonal Antibody (orb584528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150647

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD22 Antibody / BL-CAM
V8638-100UG 100 µg

Recombinant CD22 Antibody / BL-CAM

Sign In for Pricing
View Details
DRC3 Antibody - C-terminal region : FITC (ARP70798_P050-FITC)
ARP70798_P050-FITC 100 µL

DRC3 Antibody - C-terminal region : FITC (ARP70798_P050-FITC)

Sign In for Pricing
View Details
Donkey Galectin 14 ELISA Kit
MBS093470 Inquire

Donkey Galectin 14 ELISA Kit

Sign In for Pricing
View Details
APC anti-human Ig light chain κ
GT09543 100 Tests

APC anti-human Ig light chain κ

Sign In for Pricing
View Details
Mouse Monoclonal ABO, Blood Group A Antigen Antibody (3-3A) [Janelia Fluor 549]
NBP2-47872JF549 0.1 mL

Mouse Monoclonal ABO, Blood Group A Antigen Antibody (3-3A) [Janelia Fluor 549]

Sign In for Pricing
View Details
Lama4-set siRNA/shRNA/RNAi Lentivector (Mouse)
26273094 4x 500 ng

Lama4-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details