Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADRA1A Peptide - C-terminal region

ADRA1A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADRA1C, ADRA1L1, ALPHA1AAR

UniProt

P35348

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADRA1A Rabbit Polyclonal Antibody (orb584528) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_150647

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKSGLKTDKSDSEQVTLRIHRKNAPAGGSGMASAKTKTHFSVRLLKFSRE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RWDD2A (NM_033411) Human Recombinant Protein
PH40526M5 20 µg

RWDD2A (NM_033411) Human Recombinant Protein

Sign In for Pricing
View Details
ETS1 associated protein II (TDP2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G10]
TA811981BM 100 µL

ETS1 associated protein II (TDP2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3G10]

Sign In for Pricing
View Details
MCE Membrane Filter, Pore:0.45(μm), Diameter: 13(mm)
FBM013MCE045 3 x 400 Membrane Filters

MCE Membrane Filter, Pore:0.45(μm), Diameter: 13(mm)

Sign In for Pricing
View Details
CYB5R3 Rabbit Monoclonal Antibody
AMRe86432-01 1 Each

CYB5R3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CYB5R3 Rabbit Monoclonal Antibody
AMRe86432-02 50 µL

CYB5R3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
CYB5R3 Rabbit Monoclonal Antibody
AMRe86432-03 100 µL

CYB5R3 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details