Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEFM Peptide - N-terminal region

TEFM Peptide - N-terminal region

Product Specifications

UniProt

Q96QE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEFM Rabbit Polyclonal Antibody (orb326736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HAH1 Double Nickase Plasmid (m2)
sc-419235-NIC-2 20 µg

HAH1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Bafisontamab Biosimilar (Monoclonal, [ (VK-CK-VH-CH1-h-CH2-CH3_L-kappa) _Fab-G1-kappa]-dimer)
A135560 100 µL

Bafisontamab Biosimilar (Monoclonal, [ (VK-CK-VH-CH1-h-CH2-CH3_L-kappa) _Fab-G1-kappa]-dimer)

Sign In for Pricing
View Details
Copeptin
E57V1188 50 µg

Copeptin

Sign In for Pricing
View Details
Krt8 ORF Vector (Mouse) (pORF)
26049014 1.0 µg DNA

Krt8 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
TNFSF14 Antibody
orb683449 100 µL

TNFSF14 Antibody

Sign In for Pricing
View Details
N, O-Didesmethyl Tramadol-d3 Hydrochloride
CS-T-91511 1 Each

N, O-Didesmethyl Tramadol-d3 Hydrochloride

Sign In for Pricing
View Details