Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEFM Peptide - N-terminal region

TEFM Peptide - N-terminal region

Product Specifications

UniProt

Q96QE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEFM Rabbit Polyclonal Antibody (orb326736) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANTES, rat recombinant
4323-20 20 µg

RANTES, rat recombinant

Sign In for Pricing
View Details
Rabbit UBCH7 IHC Antibody
orb1518574-01 10 µL

Rabbit UBCH7 IHC Antibody

Sign In for Pricing
View Details
Rabbit UBCH7 IHC Antibody
orb1518574-02 100 µL

Rabbit UBCH7 IHC Antibody

Sign In for Pricing
View Details
ATXN1 Antibody
orb670554-01 50 µg

ATXN1 Antibody

Sign In for Pricing
View Details
ATXN1 Antibody
orb670554-02 100 µg

ATXN1 Antibody

Sign In for Pricing
View Details
Fbxo32 Mouse siRNA Oligo Duplex (Locus ID 67731)
SR411984 1 Kit

Fbxo32 Mouse siRNA Oligo Duplex (Locus ID 67731)

Sign In for Pricing
View Details