INO80C Peptide - N-terminal region
INO80C Peptide - N-terminal region
Product Specifications
UniProt
Q6PI98
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INO80C Rabbit Polyclonal Antibody (orb587463) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details