Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARM1 Peptide - C-terminal region

TARM1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OLT-2

UniProt

B6A8C7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARM1 Rabbit Polyclonal Antibody (orb327113) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129158

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGTTSSNYSLGNFVRLGLAAVIVVIMGAFLVEAWYSRNVSPGESEAFKPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal DNMBP Antibody (monoclonal) (M03), Clone: 3H7
AMM03465G 0.1mg

Monoclonal DNMBP Antibody (monoclonal) (M03), Clone: 3H7

Sign In for Pricing
View Details
Anti-epithelial Sodium Channel alpha/SCNN1A Antibody Picoband® Fluoro647 Conjugated
A01413-2-Fluoro647 100 µg/Vial

Anti-epithelial Sodium Channel alpha/SCNN1A Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit
RD-SLC30A5-Hu-96Tests 96 Tests

Human Solute Carrier Family 30, Member 5 (SLC30A5) ELISA Kit

Sign In for Pricing
View Details
Bulk Anti-Human PD-L2 (3.2) Antibody
ICH1031-5mg 5 mg

Bulk Anti-Human PD-L2 (3.2) Antibody

Sign In for Pricing
View Details
Mouse Protein DBF4 homolog A, Dbf4 ELISA KIT
ELI-48368m 96 Tests

Mouse Protein DBF4 homolog A, Dbf4 ELISA KIT

Sign In for Pricing
View Details
KIR3DL1 Polyclonal Antibody, Biotin Conjugated
bs-2421R-Biotin 100 µL

KIR3DL1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details