TMEM202 Peptide - C-terminal region
TMEM202 Peptide - C-terminal region
Product Specifications
UniProt
A6NGA9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM202 Rabbit Polyclonal Antibody (orb327129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001073931
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471387-500 1x 500 µL
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681528-100 1x 100 µL
BTLA (BTLA/1528), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]](https://cdn.genprice.uk/products/937/68dd1b86061270361ea20923/imageurl/ta812045am.webp)
TA812045AM 100 µL
Apolipoprotein L 1 (APOL1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B7]
Sign In for Pricing
View Details