TMEM202 Peptide - C-terminal region
TMEM202 Peptide - C-terminal region
Product Specifications
UniProt
A6NGA9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM202 Rabbit Polyclonal Antibody (orb327129) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001073931
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LNYLTSRSPACDENVTVIPTERSRLGVGPVTTVSPAKDEGPRSEMESLSV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401143-100 1x 100 µL
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125+ ARG1/1126), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![alpha Synuclein (SNCA) (1-140) Mouse Monoclonal Antibody [Clone ID: 4H11]](https://cdn.genprice.uk/products/937/68dd189c061270361e8fcbe2/imageurl/am26400pu-l.webp)
AM26400PU-L 500 µg
alpha Synuclein (SNCA) (1-140) Mouse Monoclonal Antibody [Clone ID: 4H11]
Sign In for Pricing
View Details 
