Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS7 Peptide - N-terminal region

TMPRSS7 Peptide - N-terminal region

Product Specifications

UniProt

Q7RTY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS7 Rabbit Polyclonal Antibody (orb587778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036040

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CREB1 Antibody : FITC (Phospho-Ser133)
OAAQ00093-10T 10 Tests

Human CREB1 Antibody : FITC (Phospho-Ser133)

Sign In for Pricing
View Details
Recombinant Human IL-33 Protein (His-tag)
GB300022-H-100μg 100 μg

Recombinant Human IL-33 Protein (His-tag)

Sign In for Pricing
View Details
CHO Monoclonal Glucagon R/GCGR Antibody (crotedumab) - IgG4SP - (Dry Ice)
NBP3-28852-100ug 100 µg

CHO Monoclonal Glucagon R/GCGR Antibody (crotedumab) - IgG4SP - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase
MBS1087723-01 0.02 mg (E-Coli)

Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase

Sign In for Pricing
View Details
Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase
MBS1087723-02 0.1 mg (E-Coli)

Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase

Sign In for Pricing
View Details
Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase
MBS1087723-03 0.02 mg (Yeast)

Recombinant Burkholderia ambifaria D-tyrosyl-tRNA (Tyr) deacylase

Sign In for Pricing
View Details