Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS7 Peptide - N-terminal region

TMPRSS7 Peptide - N-terminal region

Product Specifications

UniProt

Q7RTY8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS7 Rabbit Polyclonal Antibody (orb587778) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001036040

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPEYRQKESREFLSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSNNKGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Boc- (S) -3-Amino-3- (2-thienyl) -propionic acid
CSB-DT4040 1 g

Boc- (S) -3-Amino-3- (2-thienyl) -propionic acid

Sign In for Pricing
View Details
IL-8 Polyclonal Antibody
MBS9245770-01 0.1 mL

IL-8 Polyclonal Antibody

Sign In for Pricing
View Details
IL-8 Polyclonal Antibody
MBS9245770-02 5x 0.1 mL

IL-8 Polyclonal Antibody

Sign In for Pricing
View Details
Neuregulin-2 discontinued
539576-01 30ul

Neuregulin-2 discontinued

Sign In for Pricing
View Details
Neuregulin-2 discontinued
539576-02 100 µL

Neuregulin-2 discontinued

Sign In for Pricing
View Details
Des-Arg9-[Leu8] -Bradykinin
4065 25 mg

Des-Arg9-[Leu8] -Bradykinin

Sign In for Pricing
View Details