TMPRSS11E Peptide - N-terminal region
TMPRSS11E Peptide - N-terminal region
Product Specifications
Product Name Alternative
DESC1, TMPRSS11E2
UniProt
Q9UL52
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMPRSS11E Rabbit Polyclonal Antibody (orb331398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_054777
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7081400 Inquire
Recombinant Bovine T-cell leukemia translocation-altered gene protein homolog (TCTA), partial
Sign In for Pricing
View Details 
MBS6212604-01 0.1 mL
MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (MaxLight 550)
Sign In for Pricing
View Details MBS6212604-02 5x 0.1 mL
MS4A6A (4SPAN3, CD20L3, MS4A6, Membrane-spanning 4-domains Subfamily A Member 6A, CD20 Antigen-like 3, Four-span Transmembrane Protein 3, MGC131944, MGC22650, MST090) (MaxLight 550)
Sign In for Pricing
View Details MBS6486879-01 0.2 mL
MARK3, CT (MAP/microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/threonine-protein Kinase p78) (PE
Sign In for Pricing
View Details MBS6486879-02 5x 0.2 mL
MARK3, CT (MAP/microtubule Affinity-regulating Kinase 3, Cdc25C-associated Protein Kinase 1, cTAK1, C-TAK1, ELKL Motif Kinase 2, EMK2, EMK-2, KP78, Protein Kinase STK10, Ser/Thr Protein Kinase PAR-1, PAR1A, Par-1a, Serine/threonine-protein Kinase p78) (PE
Sign In for Pricing
View Details 
C5071-10V-ML405 100 µL
C10orf66, CT (CUE Domain-containing Protein 2, HOYS6, CUEDC2) (MaxLight 405) discontinued
Sign In for Pricing
View Details