Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11E Peptide - N-terminal region

TMPRSS11E Peptide - N-terminal region

Product Specifications

Product Name Alternative

DESC1, TMPRSS11E2

UniProt

Q9UL52

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS11E Rabbit Polyclonal Antibody (orb331398) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_054777

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIGLTVHYVRYNQKKTYNYYSTLSFTTDKLYAEFGREASNNFTEMSQRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mir3104 qPCR Primer Pair
QM79770S 200 Tests

Mouse Mir3104 qPCR Primer Pair

Sign In for Pricing
View Details
PPBP Antibody, Biotin conjugated
CSB-PA09014D0Rb-01 50 µg

PPBP Antibody, Biotin conjugated

Sign In for Pricing
View Details
PPBP Antibody, Biotin conjugated
CSB-PA09014D0Rb-02 100 µg

PPBP Antibody, Biotin conjugated

Sign In for Pricing
View Details
ARL8A Antibody
CSB-PA842642LA01HU-01 50 µg

ARL8A Antibody

Sign In for Pricing
View Details
ARL8A Antibody
CSB-PA842642LA01HU-02 100 µg

ARL8A Antibody

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)
MBS1313058-01 0.02 mg (E-Coli)

Recombinant Human Leucine-rich repeat-containing protein 1 (LRRC1)

Sign In for Pricing
View Details