Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMPRSS11F Peptide - C-terminal region

TMPRSS11F Peptide - C-terminal region

Product Specifications

UniProt

Q6ZWK6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS11F Rabbit Polyclonal Antibody (orb331399) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997290

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IILHENYHRETNENDIALVQLSTGVEFSNIVQRVCLPDSSIKLPPKTSVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal LRIG1 Antibody [Alexa Fluor 594]
NBP3-18504AF594 0.1 mL

Rabbit Polyclonal LRIG1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
PLA2G3, CT (PLA2G3, Group 3 secretory phospholipase A2, Group III secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 3) (FITC)
MBS6334545-01 0.2 mL

PLA2G3, CT (PLA2G3, Group 3 secretory phospholipase A2, Group III secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 3) (FITC)

Sign In for Pricing
View Details
PLA2G3, CT (PLA2G3, Group 3 secretory phospholipase A2, Group III secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 3) (FITC)
MBS6334545-02 5x 0.2 mL

PLA2G3, CT (PLA2G3, Group 3 secretory phospholipase A2, Group III secretory phospholipase A2, Phosphatidylcholine 2-acylhydrolase 3) (FITC)

Sign In for Pricing
View Details
Donkey Neuroligin 2 (NLGN2) ELISA Kit
MBS9915347 Inquire

Donkey Neuroligin 2 (NLGN2) ELISA Kit

Sign In for Pricing
View Details
Human INTS10 Pre-designed siRNA Set A
SI007708A 1 Each

Human INTS10 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Ifi27 AAV siRNA Pooled Vector
24213166 1.0 µg

Ifi27 AAV siRNA Pooled Vector

Sign In for Pricing
View Details