TRIM16 Peptide - middle region
TRIM16 Peptide - middle region
Product Specifications
Product Name Alternative
EBBP
UniProt
O95361
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM16 Rabbit Polyclonal Antibody (orb587780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006461
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRV-0033296-01 20 µL
Monoclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
Sign In for Pricing
View Details TRV-0033296-02 100 µL
Monoclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
Sign In for Pricing
View Details TRV-0033296-03 200 µL
Monoclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
Sign In for Pricing
View Details TRV-0033296-04 1 mL
Monoclonal Antibody to Creatine Kinase, Mitochondrial 1A (CKMT1A)
Sign In for Pricing
View Details 
MBS2076891-01 0.1 mL
FITC-Linked Polyclonal Antibody to Uroplakin 3A (UPK3A)
Sign In for Pricing
View Details MBS2076891-02 0.2 mL
FITC-Linked Polyclonal Antibody to Uroplakin 3A (UPK3A)
Sign In for Pricing
View Details