TRIM16 Peptide - middle region
TRIM16 Peptide - middle region
Product Specifications
Product Name Alternative
EBBP
UniProt
O95361
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM16 Rabbit Polyclonal Antibody (orb587780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006461
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAGTYVGLTCKGIDRKGEERNSCISGNNFSWSLQWNGKEFTAWYSDMETP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15254204 1 Vial
Lentiviral mouse Smpx shRNA (UAS) - Lentiviral mouseSmpx shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details 
MBS146690-01 0.005 mg
Mouse Anti Human Proliferation-associated protein 2G4
Sign In for Pricing
View Details MBS146690-02 0.02 mg
Mouse Anti Human Proliferation-associated protein 2G4
Sign In for Pricing
View Details MBS146690-03 0.1 mg
Mouse Anti Human Proliferation-associated protein 2G4
Sign In for Pricing
View Details