Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM16L Peptide - N-terminal region

TRIM16L Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRIM70

UniProt

Q309B1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM16L Rabbit Polyclonal Antibody (orb587781) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032407

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cis-2-pentenenitrile
TRC-C284841-250MG 250 mg

Cis-2-pentenenitrile

Sign In for Pricing
View Details
Red Clover Extract
HY-N13216 1 Each

Red Clover Extract

Sign In for Pricing
View Details
Serpinb11 3'UTR Luciferase Stable Cell Line
TU220170 1.0 mL

Serpinb11 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Compound 113438-59-8
TPL0014-01 200 mg

Compound 113438-59-8

Sign In for Pricing
View Details
Compound 113438-59-8
TPL0014-02 5 mg

Compound 113438-59-8

Sign In for Pricing
View Details
Compound 113438-59-8
TPL0014-03 25 mg

Compound 113438-59-8

Sign In for Pricing
View Details