TRIM16L Peptide - N-terminal region
TRIM16L Peptide - N-terminal region
Product Specifications
Product Name Alternative
TRIM70
UniProt
Q309B1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM16L Rabbit Polyclonal Antibody (orb587781) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032407
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELETMAAIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2813606-01 48 Tests
Human Brain Natriuretic Peptide (BNP) ELISA Kit
Sign In for Pricing
View Details orb2813606-02 96 Tests
Human Brain Natriuretic Peptide (BNP) ELISA Kit
Sign In for Pricing
View Details orb2813606-03 5 x 96 T
Human Brain Natriuretic Peptide (BNP) ELISA Kit
Sign In for Pricing
View Details M13347-carrier-free 100 µL
Anti-Lambda Light chain IGLV1-51 Monoclonal Antibody, Carrier-free
Sign In for Pricing
View Details 