TRIM64 Peptide - N-terminal region
TRIM64 Peptide - N-terminal region
Product Specifications
Product Name Alternative
C11orf28, TRIM64A
UniProt
A6NGJ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM64 Rabbit Polyclonal Antibody (orb587782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001129958
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KPNFNTNVVLKKLSSLARQTRPQNINSSDNICVLHEETKELFCEADKRLL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683794-100 1x 100 µL
Frataxin (Mitochondrial Marker) (rFXN/2124), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
HA750859 100 µL
Ketohexokinase Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
