Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM64 Peptide - N-terminal region

TRIM64 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf28, TRIM64A

UniProt

A6NGJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM64 Rabbit Polyclonal Antibody (orb587782) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129958

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KPNFNTNVVLKKLSSLARQTRPQNINSSDNICVLHEETKELFCEADKRLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDST1 Human Gene Knockout Kit (CRISPR)
KN221638BN 1 Kit

NDST1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Crude Ulex europaeus Lectin (GorseFurze) -UEA-I-
L-2200-100 100 mg

Crude Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700062 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
C1QA Rabbit Monoclonal Antibody
TA422465 100 µL

C1QA Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SCAMP2 Rabbit Polyclonal Antibody
TA361591 100 µL

SCAMP2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Benzyl D-Glucopyranoside (alpha & beta Mixture) (>90%)
TRC-B276750-5G 5 g

Benzyl D-Glucopyranoside (alpha & beta Mixture) (>90%)

Sign In for Pricing
View Details