TSPAN11 Peptide - middle region
TSPAN11 Peptide - middle region
Product Specifications
Product Name Alternative
VSSW1971
UniProt
A1L157
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TSPAN11 Rabbit Polyclonal Antibody (orb327131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001073978
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLRE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15093603 1 Vial
Lentiviral human UBAC2 shRNA (UAS) - Lentiviral human UBAC2 shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details 
E-EL-H2435 96 Tests
ELISA kit for Human LOXL4 (Lysyl Oxidase Like Protein 4)
Sign In for Pricing
View Details 