Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC24 Peptide - C-terminal region

TTC24 Peptide - C-terminal region

Product Specifications

UniProt

A2A3L6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC24 Rabbit Polyclonal Antibody (orb327133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099139

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FGF2 Protein (GST Tag)
PDEH100489-01 20 µg

Recombinant Human FGF2 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human FGF2 Protein (GST Tag)
PDEH100489-02 100 µg

Recombinant Human FGF2 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human FGF2 Protein (GST Tag)
PDEH100489-03 500 µg

Recombinant Human FGF2 Protein (GST Tag)

Sign In for Pricing
View Details
Recombinant Human FGF2 Protein (GST Tag)
PDEH100489-04 1 mg

Recombinant Human FGF2 Protein (GST Tag)

Sign In for Pricing
View Details
1 impurity 5-13C,d3
TRC-I584840-25MG 25 mg

1 impurity 5-13C,d3

Sign In for Pricing
View Details
Tmem168 Mouse Gene Knockout Kit (CRISPR)
KN517751 1 Kit

Tmem168 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details