Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC24 Peptide - C-terminal region

TTC24 Peptide - C-terminal region

Product Specifications

UniProt

A2A3L6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC24 Rabbit Polyclonal Antibody (orb327133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099139

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRSSSGWEDEEFEEGHQKKKEERSANVPVRAGPGRPELCFLPGTVNHSHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGP 9.5 Polyclonal Antibody
E-AB-70251-01 60 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
PGP 9.5 Polyclonal Antibody
E-AB-70251-02 120 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
PGP 9.5 Polyclonal Antibody
E-AB-70251-03 200 µL

PGP 9.5 Polyclonal Antibody

Sign In for Pricing
View Details
USP22 Human Gene Knockout Kit (CRISPR)
KN419906 1 Kit

USP22 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), 0.2mg/mL
BNUB3019-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), 0.2mg/mL

Sign In for Pricing
View Details
SERCA2 (ATP2A2) Human Knockdown Lysate
LY300062 100 µg

SERCA2 (ATP2A2) Human Knockdown Lysate

Sign In for Pricing
View Details