Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC26 Peptide - N-terminal region

TTC26 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DYF13, dyf-13

UniProt

A0AVF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC26 Rabbit Polyclonal Antibody (orb587787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079202

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PICK1 (Protein Interacting With Protein Kinase C, Alpha 1) BioAssayTM ELISA Kit (Rat) discontinued
384067 96 Tests

PICK1 (Protein Interacting With Protein Kinase C, Alpha 1) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Human FAM187B knockout cell line
ABC-KH5170 1 Vial

Human FAM187B knockout cell line

Sign In for Pricing
View Details
PKC iota Antibody
ASA-B1534 1 Each

PKC iota Antibody

Sign In for Pricing
View Details
EDA2R Antibody
orb520730-01 50 μL

EDA2R Antibody

Sign In for Pricing
View Details
EDA2R Antibody
orb520730-02 100 µL

EDA2R Antibody

Sign In for Pricing
View Details
ACY1 antibody
70R-15579 50 ul

ACY1 antibody

Sign In for Pricing
View Details