Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC26 Peptide - N-terminal region

TTC26 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DYF13, dyf-13

UniProt

A0AVF1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC26 Rabbit Polyclonal Antibody (orb587787) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079202

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEFKRHVGEEEEDTNLWIGYCAFHLGDYKRALEEYENATKEENCNSEVWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNTT Protein (N-His, Bovine)
P514800 100 µg

DNTT Protein (N-His, Bovine)

Sign In for Pricing
View Details
ChamQ Geno-SNP Probe Master Mix
Q811-02 500 Reactions

ChamQ Geno-SNP Probe Master Mix

Sign In for Pricing
View Details
AS 605240
254680-01 10 mg

AS 605240

Sign In for Pricing
View Details
AS 605240
254680-02 50 mg

AS 605240

Sign In for Pricing
View Details
Human Frizzled 4 (FZD4) (NM_012193) AAV Particle
RC217286A1V 250 µL

Human Frizzled 4 (FZD4) (NM_012193) AAV Particle

Sign In for Pricing
View Details
Lentiviral human NKD2 sgRNA gene knockout kit - Lentiviral human NKD2 sgRNA gene knockout kit (25)
GTR15387147 1 Vial

Lentiviral human NKD2 sgRNA gene knockout kit - Lentiviral human NKD2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details