Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39C Peptide - middle region

TTC39C Peptide - middle region

Product Specifications

Product Name Alternative

C18orf17, HsT2697

UniProt

Q8N584

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC39C Rabbit Polyclonal Antibody (orb327134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694943

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HLA A Antibody (108-2C5) [mFluor Violet 610 SE]
NBP3-11420MFV610 0.1 mL

Mouse Monoclonal HLA A Antibody (108-2C5) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Pds5b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7346805 3x 1.0 µg

Pds5b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Armt1 (NM_024261) Mouse Tagged ORF Clone Lentiviral Particle
MR214194L3V 200 µL

Armt1 (NM_024261) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MUC1 Antibody
37857 100 µL

MUC1 Antibody

Sign In for Pricing
View Details
Npc2 siRNA Oligos set (Mouse)
32046174 3x 5 nmol

Npc2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Phospho-c-Myb (Ser 11) Rabbit mAb
F1606-20uL 20 µL

Phospho-c-Myb (Ser 11) Rabbit mAb

Sign In for Pricing
View Details