Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC39C Peptide - middle region

TTC39C Peptide - middle region

Product Specifications

Product Name Alternative

C18orf17, HsT2697

UniProt

Q8N584

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC39C Rabbit Polyclonal Antibody (orb327134) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_694943

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLLKIINLLGFPGDRLQGLSSLMYASESKDMKAPLATLALLWYHTVVRPF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD115 Blocking Peptide
orb392959-01 1 mg

CD115 Blocking Peptide

Sign In for Pricing
View Details
CD115 Blocking Peptide
orb392959-02 5 mg

CD115 Blocking Peptide

Sign In for Pricing
View Details
Tmem191c (NM_177473) Mouse Tagged ORF Clone
MG212248 10 µg

Tmem191c (NM_177473) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
EAP30 (SNF8) (NM_007241) Human Tagged ORF Clone Lentiviral Particle
RC202137L4V 200 µL

EAP30 (SNF8) (NM_007241) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-Trop2 antibody (DM74), Rabbit mAb
MBS188206-01 0.01 mg

Anti-Trop2 antibody (DM74), Rabbit mAb

Sign In for Pricing
View Details
Anti-Trop2 antibody (DM74), Rabbit mAb
MBS188206-02 0.1 mg

Anti-Trop2 antibody (DM74), Rabbit mAb

Sign In for Pricing
View Details