Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP41 Peptide - C-terminal region

USP41 Peptide - C-terminal region

Product Specifications

UniProt

Q3LFD5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP41 Rabbit Polyclonal Antibody (orb327143) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD6 (C6/372 + 3F7B5), CF568 conjugate, 0.1mg/mL
BNC681228-500 1x 500 µL

CD6 (C6/372 + 3F7B5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smad2 Mouse Monoclonal Antibody [C9-B0]
EM1701-44 100 µL

Smad2 Mouse Monoclonal Antibody [C9-B0]

Sign In for Pricing
View Details
6-Benzyloxy-1-cyclopropyl-1,4-dihydro-7-fluoro-4-oxo-3-quinolinecarboxylic Acid Benzyl Ester
TRC-B287985-25MG 25 mg

6-Benzyloxy-1-cyclopropyl-1,4-dihydro-7-fluoro-4-oxo-3-quinolinecarboxylic Acid Benzyl Ester

Sign In for Pricing
View Details
Glycine 6-Ethylchenodeoxycholate
TRC-G625250-50MG 50 mg

Glycine 6-Ethylchenodeoxycholate

Sign In for Pricing
View Details
GABA A Receptor alpha 1 (GABRA1) (NM_000806) Human Over-expression Lysate
LY400282 100 µg

GABA A Receptor alpha 1 (GABRA1) (NM_000806) Human Over-expression Lysate

Sign In for Pricing
View Details
Phenylalanine ammonia-lyase Microplate Assay Kit
RDSM018 100 Assays

Phenylalanine ammonia-lyase Microplate Assay Kit

Sign In for Pricing
View Details