Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UTP11 Peptide - N-terminal region

UTP11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CGI94, CGI-94, UTP11L

UniProt

Q9Y3A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UTP11 Rabbit Polyclonal Antibody (orb327144) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057121

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKSRQREHRERSQPGFRKHLGLLEKKKDYKLRADDYRKKQEYLKALRKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human WFDC2/WAP5 Monoclonal Antibody (1A083)
MHG80904 100 μg

Anti-Human WFDC2/WAP5 Monoclonal Antibody (1A083)

Sign In for Pricing
View Details
Antibacterial agent 53
MBS5799450 Inquire

Antibacterial agent 53

Sign In for Pricing
View Details
Calumenin (CALU) (APC)
MBS6409304-01 0.1 mL

Calumenin (CALU) (APC)

Sign In for Pricing
View Details
Calumenin (CALU) (APC)
MBS6409304-02 5x 0.1 mL

Calumenin (CALU) (APC)

Sign In for Pricing
View Details
Rabbit LBP (Lipopolysaccharide Binding Protein) ELISA Kit
MBS2506086-01 24 Tests

Rabbit LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit LBP (Lipopolysaccharide Binding Protein) ELISA Kit
MBS2506086-02 48 Tests

Rabbit LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details